LL-37 peptide is also known as:
- Human cathelicidin antimicrobial peptide (hCAP-18)
- FALL-39
- Cathelin-associated antimicrobial peptide (CAMP)
- hCAP
- Cap37
- [LL-37, 37 aa]
- Cationic antimicrobial peptide 37 (LL37)
- Cationic peptide LL-37
- Cathelicidin-related antimicrobial peptide LL-37
- Cationic host defense peptide LL-37
- Human inducible cathelicidin antimicrobial peptide (hICAMP)
- Human LL-37 peptide
LL-37 peptide is a naturally occurring antimicrobial peptide that is produced by a variety of cell types, including epithelial cells, neutrophils, and macrophages. It is a 37-amino acid peptide with a wide range of biological activities, including antimicrobial, anti-inflammatory, immunomodulatory, wound healing, and anti-cancer activities.
LL-37 peptide is thought to work by disrupting the cell membranes of bacteria, fungi, and viruses. It can also induce cell death and apoptosis in microbial cells. LL-37 peptide also has the ability to attract and activate immune cells, which helps to fight infection.
In addition to its antimicrobial and immunomodulatory activities, LL-37 peptide also plays a role in wound healing and tissue regeneration. It can promote the proliferation and migration of keratinocytes and fibroblasts. LL-37 peptide also has anti-angiogenic and anti-tumor activities.
LL-37 peptide is a promising therapeutic agent for a variety of conditions, including infections, inflammatory diseases, and cancer. However, more research is needed to fully understand its mechanisms of action and to develop effective delivery strategies.
Here are some of the potential therapeutic applications of LL-37 peptide:
- Anti-infective therapy: LL-37 peptide is a potent antimicrobial agent against a wide range of bacteria, fungi, and viruses. It could be used to treat infections that are resistant to conventional antibiotics.
- Inflammatory diseases: LL-37 peptide has anti-inflammatory and immunomodulatory activities. It could be used to treat inflammatory diseases such as asthma, arthritis, and inflammatory bowel disease.
- Cancer therapy: LL-37 peptide has anti-angiogenic and anti-tumor activities. It could be used to treat cancer by inhibiting the growth and spread of tumors.
- Wound healing: LL-37 peptide promotes the proliferation and migration of keratinocytes and fibroblasts. It could be used to accelerate wound healing and tissue regeneration.
LL-37 peptide is still in the early stages of development as a therapeutic agent. However, the results of preclinical and clinical studies to date suggest that LL-37 peptide has the potential to revolutionize the treatment of a wide range of diseases.
