Medical Vendor Reviews

Peptide

What is Melanotan II?

Melanotan II is a synthetic analogue of the peptide hormone alpha-melanocyte stimulating hormone (α-MSH). α-MSH is produced naturally in the body and stimulates the production of melanin, the pigment that gives skin, hair, and eyes their color. Melanotan II is not approved by the US Food and Drug Administration (FDA) for any medical use. However,

What is Melanotan II? Read More »

List of Research Studies About LL-37 Peptide

Here is a list of research studies about LL-37 peptide: LL-37 Peptide as a Potential Treatment for Drug-Resistant Infections. This study investigated the efficacy of LL-37 peptide against a variety of drug-resistant bacteria, including methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin-resistant Enterococcus (VRE). The study found that LL-37 peptide was effective in killing all of the tested bacteria,

List of Research Studies About LL-37 Peptide Read More »

What are The Known Side Effects of LL-37 Peptide?

LL-37 peptide is a naturally occurring antimicrobial peptide with a wide range of potential therapeutic applications. It is currently being investigated as a potential treatment for a variety of conditions, including infections, inflammatory diseases, cancer, wound healing, and cystic fibrosis. The known side effects of LL-37 peptide are generally mild and transient. The most common

What are The Known Side Effects of LL-37 Peptide? Read More »

LL-37 Peptide is also Known as?

LL-37 peptide is also known as: Human cathelicidin antimicrobial peptide (hCAP-18) FALL-39 Cathelin-associated antimicrobial peptide (CAMP) hCAP Cap37 [LL-37, 37 aa] Cationic antimicrobial peptide 37 (LL37) Cationic peptide LL-37 Cathelicidin-related antimicrobial peptide LL-37 Cationic host defense peptide LL-37 Human inducible cathelicidin antimicrobial peptide (hICAMP) Human LL-37 peptide LL-37 peptide is a naturally occurring antimicrobial peptide that is

LL-37 Peptide is also Known as? Read More »

LL-37 Peptide Research

LL-37 peptide is a naturally occurring antimicrobial peptide with a wide range of potential therapeutic applications. It is currently being investigated as a potential treatment for a variety of conditions, including: Infections: LL-37 peptide is a potent antimicrobial agent against a wide range of bacteria, fungi, and viruses. It is being investigated as a potential treatment

LL-37 Peptide Research Read More »

LL-37 Peptide Structure

LL-37 peptide is a naturally occurring antimicrobial peptide that is produced by a variety of cell types, including epithelial cells, neutrophils, and macrophages. It is a 37-amino acid peptide with the following sequence: [LL-37, 37 aa] LL-37 peptide is a cationic peptide, which means that it has a positive charge. This is due to the presence of

LL-37 Peptide Structure Read More »