Medical Vendor Reviews

Matt

PT-141 Peptide History

PT-141, also known as bremelanotide, is a synthetic peptide that was first developed in the 1990s by Palatin Technologies. It was originally developed as a potential treatment for obesity, but it was later discovered to have aphrodisiac properties. Palatin Technologies began clinical trials of PT-141 for the treatment of female sexual dysfunction in 1998. The […]

PT-141 Peptide History Read More »

What is PT-141?

PT-141, also known as bremelanotide, is a synthetic peptide that is being investigated as a potential treatment for sexual dysfunction in both men and women. It is a melanocortin receptor agonist, meaning that it binds to and activates melanocortin receptors in the brain. Melanocortin receptors are involved in a variety of physiological functions, including appetite,

What is PT-141? Read More »

What are The Known Side Effects of PNC-27 Peptide?

The known side effects of PNC-27 peptide are mostly mild and go away on their own. These side effects may include: Nausea Vomiting Diarrhea Fatigue Headache Dizziness More serious side effects of PNC-27 peptide are rare. These side effects may include: Liver toxicity Kidney toxicity Myelosuppression (bone marrow suppression) Here is a more detailed description

What are The Known Side Effects of PNC-27 Peptide? Read More »

PNC-27 Peptide is also Known as?

PNC-27 peptide is also known as: HDM2-binding peptide Membrane-active peptide Tumor-penetrating peptide Penetratin-p53 peptide OncoSec Medical Systems 102 OSI-102 PNC-27 was initially developed by a team of researchers at the University of Pennsylvania and was later licensed to OncoSec Medical Systems. OncoSec Medical Systems is currently developing PNC-27 for the treatment of a variety of

PNC-27 Peptide is also Known as? Read More »

PNC-27 Peptide Structure

PNC-27 is a synthetic peptide that is being investigated as a potential treatment for cancer. It is a 27-amino acid peptide with the following sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG PNC-27 has a unique amphipathic structure, which means that it has both hydrophilic (water-loving) and hydrophobic (water-fearing) regions. This type of structure is common in membrane-active peptides, which are

PNC-27 Peptide Structure Read More »